NCLN polyclonal antibody (A01)
  • NCLN polyclonal antibody (A01)

NCLN polyclonal antibody (A01)

Ref: AB-H00056926-A01
NCLN polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NCLN.
Información adicional
Size 50 uL
Gene Name NCLN
Gene Alias -
Gene Description nicalin homolog (zebrafish)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq HEFTVYRMQQYDLQGQPYGTRNAVLNTEARTMAAEVLSRRCVLMRLLDFSYEQYQKALRQSAGAVVIILPRAMAAVPQDVVRQFMEIEPEMLAMETAVPVY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NCLN (NP_064555, 44 a.a. ~ 144 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56926

Enviar un mensaje


NCLN polyclonal antibody (A01)

NCLN polyclonal antibody (A01)