LXN MaxPab mouse polyclonal antibody (B01P)
  • LXN MaxPab mouse polyclonal antibody (B01P)

LXN MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00056925-B01P
LXN MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LXN protein.
Información adicional
Size 50 ug
Gene Name LXN
Gene Alias ECI|TCI
Gene Description latexin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LXN (NP_064554.2, 1 a.a. ~ 222 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56925

Enviar un mensaje


LXN MaxPab mouse polyclonal antibody (B01P)

LXN MaxPab mouse polyclonal antibody (B01P)