MEIS3 purified MaxPab mouse polyclonal antibody (B01P)
  • MEIS3 purified MaxPab mouse polyclonal antibody (B01P)

MEIS3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00056917-B01P
MEIS3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MEIS3 protein.
Información adicional
Size 50 ug
Gene Name MEIS3
Gene Alias DKFZp547H236|MRG2
Gene Description Meis homeobox 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDED
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MEIS3 (NP_064545.1, 1 a.a. ~ 421 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56917

Enviar un mensaje


MEIS3 purified MaxPab mouse polyclonal antibody (B01P)

MEIS3 purified MaxPab mouse polyclonal antibody (B01P)