DPYSL5 MaxPab rabbit polyclonal antibody (D01)
  • DPYSL5 MaxPab rabbit polyclonal antibody (D01)

DPYSL5 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00056896-D01
DPYSL5 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DPYSL5 protein.
Información adicional
Size 100 uL
Gene Name DPYSL5
Gene Alias CRAM|CRMP-5|CRMP5|FLJ45383|Ulip6
Gene Description dihydropyrimidinase-like 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MLANSASVRILIKGGKVVNDDCTHEADVYIENGIIQQVGRELMIPGGAKVIDATGKLVIPGGIDTSTHFHQTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPDKETSLVDAYEKCRGLADPKVCCDYALHVGITWWAPKVKAEMETLVREKGVNSFQMFMTYKDLYMLRDSELYQVLHACKDIGAIARVHAENGELVAEGAKEALDLGITGPEGIEISRPEELEAEATHRVITIANRTHCPIYLVNVSSISAGD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DPYSL5 (NP_064519.2, 1 a.a. ~ 564 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 56896

Enviar un mensaje


DPYSL5 MaxPab rabbit polyclonal antibody (D01)

DPYSL5 MaxPab rabbit polyclonal antibody (D01)