MDM1 purified MaxPab mouse polyclonal antibody (B01P)
  • MDM1 purified MaxPab mouse polyclonal antibody (B01P)

MDM1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00056890-B01P
MDM1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MDM1 protein.
Información adicional
Size 50 ug
Gene Name MDM1
Gene Alias FLJ95264
Gene Description Mdm1 nuclear protein homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPVRFKGLSEYQRNFLWKKSYLSESCNSSVGRKYPWAGLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPEAPETPKSQEAEQKDVIQERVHSLEASRVPKRTRSHSADSRAEGASDVENNEGVTNHTPVNENVELEHSTKVLSENVDNGLDRLLRKKAGLTVVPSYNALRNSEYQRQFVWKTSKETAPAFAANQVFHNKSQFVPPFKGNSVIHETEYKRNFKGLSPVKEPKLRNDLRE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MDM1 (NP_059136.1, 1 a.a. ~ 714 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56890

Enviar un mensaje


MDM1 purified MaxPab mouse polyclonal antibody (B01P)

MDM1 purified MaxPab mouse polyclonal antibody (B01P)