RAD18 MaxPab rabbit polyclonal antibody (D01)
  • RAD18 MaxPab rabbit polyclonal antibody (D01)

RAD18 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00056852-D01
RAD18 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RAD18 protein.
Información adicional
Size 100 uL
Gene Name RAD18
Gene Alias RNF73
Gene Description RAD18 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAD18 (NP_064550.2, 1 a.a. ~ 495 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 56852

Enviar un mensaje


RAD18 MaxPab rabbit polyclonal antibody (D01)

RAD18 MaxPab rabbit polyclonal antibody (D01)