RAD18 polyclonal antibody (A01)
  • RAD18 polyclonal antibody (A01)

RAD18 polyclonal antibody (A01)

Ref: AB-H00056852-A01
RAD18 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RAD18.
Información adicional
Size 50 uL
Gene Name RAD18
Gene Alias RNF73
Gene Description RAD18 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAD18 (NP_064550, 332 a.a. ~ 430 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56852

Enviar un mensaje


RAD18 polyclonal antibody (A01)

RAD18 polyclonal antibody (A01)