IFNK polyclonal antibody (A01)
  • IFNK polyclonal antibody (A01)

IFNK polyclonal antibody (A01)

Ref: AB-H00056832-A01
IFNK polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IFNK.
Información adicional
Size 50 uL
Gene Name IFNK
Gene Alias RP11-27J8.1
Gene Description interferon, kappa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IFNK (NP_064509, 35 a.a. ~ 129 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56832

Enviar un mensaje


IFNK polyclonal antibody (A01)

IFNK polyclonal antibody (A01)