RETN purified MaxPab rabbit polyclonal antibody (D01P)
  • RETN purified MaxPab rabbit polyclonal antibody (D01P)

RETN purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00056729-D01P
RETN purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RETN protein.
Información adicional
Size 100 ug
Gene Name RETN
Gene Alias ADSF|FIZZ3|MGC126603|MGC126609|RETN1|RSTN|XCP1
Gene Description resistin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RETN (AAI01555.1, 1 a.a. ~ 108 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56729

Enviar un mensaje


RETN purified MaxPab rabbit polyclonal antibody (D01P)

RETN purified MaxPab rabbit polyclonal antibody (D01P)