ASCL3 monoclonal antibody (M02), clone 2F8
  • ASCL3 monoclonal antibody (M02), clone 2F8

ASCL3 monoclonal antibody (M02), clone 2F8

Ref: AB-H00056676-M02
ASCL3 monoclonal antibody (M02), clone 2F8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ASCL3.
Información adicional
Size 100 ug
Gene Name ASCL3
Gene Alias HASH3|SGN1|bHLHa42
Gene Description achaete-scute complex homolog 3 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MMDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEPCPFSFPMPYPNYRGCEYSYGPAFT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ASCL3 (NP_065697.1, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56676
Clone Number 2F8
Iso type IgG2a Kappa

Enviar un mensaje


ASCL3 monoclonal antibody (M02), clone 2F8

ASCL3 monoclonal antibody (M02), clone 2F8