KCNK12 polyclonal antibody (A01)
  • KCNK12 polyclonal antibody (A01)

KCNK12 polyclonal antibody (A01)

Ref: AB-H00056660-A01
KCNK12 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KCNK12.
Información adicional
Size 50 uL
Gene Name KCNK12
Gene Alias THIK-2|THIK2
Gene Description potassium channel, subfamily K, member 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ERIISLLAFIMRACRERQLRRSGLLPATFRRGSALSEADSLAGWKPSVYH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KCNK12 (NP_071338, 166 a.a. ~ 215 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56660

Enviar un mensaje


KCNK12 polyclonal antibody (A01)

KCNK12 polyclonal antibody (A01)