MMP26 monoclonal antibody (M02A), clone 3B9
  • MMP26 monoclonal antibody (M02A), clone 3B9

MMP26 monoclonal antibody (M02A), clone 3B9

Ref: AB-H00056547-M02A
MMP26 monoclonal antibody (M02A), clone 3B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MMP26.
Información adicional
Size 200 uL
Gene Name MMP26
Gene Alias MGC126590|MGC126592
Gene Description matrix metallopeptidase 26
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MMP26 (NP_068573, 152 a.a. ~ 261 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 56547
Clone Number 3B9
Iso type IgG1 Kappa

Enviar un mensaje


MMP26 monoclonal antibody (M02A), clone 3B9

MMP26 monoclonal antibody (M02A), clone 3B9