EIF4ENIF1 MaxPab rabbit polyclonal antibody (D01)
  • EIF4ENIF1 MaxPab rabbit polyclonal antibody (D01)

EIF4ENIF1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00056478-D01
EIF4ENIF1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EIF4ENIF1 protein.
Información adicional
Size 100 uL
Gene Name EIF4ENIF1
Gene Alias 4E-T|Clast4|FLJ21601|FLJ26551
Gene Description eukaryotic translation initiation factor 4E nuclear import factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MDRRSMGETESGDAFLDLKKPPASKCPHRYTKEELLDIKELPHSKQRPSCLSEKYDSDGVWDPEKWHASLYPASGRSSPVESLKKELDTDRPSLVRRIVDPRERVKEDDLDVVLSPQRRSFGGGCHVTAAVSSRRSGSPLEKDSDGLRLLGGRRIGSGRIISARTFEKDHRLSDKDLRDLRDRDRERDFKDKRFRREFGDSKRVFGERRRNDSYTEEEPEWFSAGPTSQSETIELTGFDDKILEEDHKGRKRTRR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EIF4ENIF1 (AAH33028.1, 1 a.a. ~ 985 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 56478

Enviar un mensaje


EIF4ENIF1 MaxPab rabbit polyclonal antibody (D01)

EIF4ENIF1 MaxPab rabbit polyclonal antibody (D01)