EIF4ENIF1 polyclonal antibody (A01)
  • EIF4ENIF1 polyclonal antibody (A01)

EIF4ENIF1 polyclonal antibody (A01)

Ref: AB-H00056478-A01
EIF4ENIF1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EIF4ENIF1.
Información adicional
Size 50 uL
Gene Name EIF4ENIF1
Gene Alias 4E-T|Clast4|FLJ21601|FLJ26551
Gene Description eukaryotic translation initiation factor 4E nuclear import factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq NPRPGTPLHLAMVQQQLQRSVLHPPGSGSHAAAVSVQTTPQNVPSRSGLPHMHSQLEHRPSQRSSSPVGLAKWFGSDVLQQPLPSMPAKVISVDELEYRQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF4ENIF1 (NP_062817, 886 a.a. ~ 985 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56478

Enviar un mensaje


EIF4ENIF1 polyclonal antibody (A01)

EIF4ENIF1 polyclonal antibody (A01)