CTPS2 purified MaxPab rabbit polyclonal antibody (D01P)
  • CTPS2 purified MaxPab rabbit polyclonal antibody (D01P)

CTPS2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00056474-D01P
CTPS2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CTPS2 protein.
Información adicional
Size 100 ug
Gene Name CTPS2
Gene Alias DKFZp686C17207|FLJ43358|MGC32997
Gene Description CTP synthase II
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDGNKEEPQICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CTPS2 (NP_062831.3, 1 a.a. ~ 586 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56474

Enviar un mensaje


CTPS2 purified MaxPab rabbit polyclonal antibody (D01P)

CTPS2 purified MaxPab rabbit polyclonal antibody (D01P)