PRMT8 purified MaxPab rabbit polyclonal antibody (D01P)
  • PRMT8 purified MaxPab rabbit polyclonal antibody (D01P)

PRMT8 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00056341-D01P
PRMT8 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PRMT8 protein.
Información adicional
Size 100 ug
Gene Name PRMT8
Gene Alias HRMT1L3|HRMT1L4
Gene Description protein arginine methyltransferase 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGMKHSSRCLLLRRKMAENAAESTEVNSPPSQPPQPVVPAKPVQCVHHVSTQPSCPGRGKMSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRMT8 (NP_062828.3, 1 a.a. ~ 394 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56341

Enviar un mensaje


PRMT8 purified MaxPab rabbit polyclonal antibody (D01P)

PRMT8 purified MaxPab rabbit polyclonal antibody (D01P)