HRMT1L4 polyclonal antibody (A01)
  • HRMT1L4 polyclonal antibody (A01)

HRMT1L4 polyclonal antibody (A01)

Ref: AB-H00056341-A01
HRMT1L4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HRMT1L4.
Información adicional
Size 50 uL
Gene Name PRMT8
Gene Alias HRMT1L3|HRMT1L4
Gene Description protein arginine methyltransferase 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq CLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HRMT1L4 (NP_062828, 235 a.a. ~ 334 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56341

Enviar un mensaje


HRMT1L4 polyclonal antibody (A01)

HRMT1L4 polyclonal antibody (A01)