TRPV5 polyclonal antibody (A01) Ver mas grande

TRPV5 polyclonal antibody (A01)

AB-H00056302-A01

Producto nuevo

TRPV5 polyclonal antibody (A01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 uL
Gene Name TRPV5
Gene Alias CAT2|ECAC1|OTRPC3
Gene Description transient receptor potential cation channel, subfamily V, member 5
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGGFLPKAEGPGSQLQKLLPSFLVREQDWDQHLDKLHMLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAALYDNLEAALVLME
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRPV5 (NP_062815, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56302

Más información

Mouse polyclonal antibody raised against a partial recombinant TRPV5.

Consulta sobre un producto

TRPV5 polyclonal antibody (A01)

TRPV5 polyclonal antibody (A01)