PARD3 purified MaxPab mouse polyclonal antibody (B01P)
  • PARD3 purified MaxPab mouse polyclonal antibody (B01P)

PARD3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00056288-B01P
PARD3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PARD3 protein.
Información adicional
Size 50 ug
Gene Name PARD3
Gene Alias ASIP|Baz|Bazooka|FLJ21015|PAR3|PAR3alpha|PARD3A|SE2-5L16|SE2-5LT1|SE2-5T2
Gene Description par-3 partitioning defective 3 homolog (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFLKQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPMVGKWLEKQEQDEDGTEEDNSRVEPVGH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PARD3 (AAH71566.1, 1 a.a. ~ 1340 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56288

Enviar un mensaje


PARD3 purified MaxPab mouse polyclonal antibody (B01P)

PARD3 purified MaxPab mouse polyclonal antibody (B01P)