MRAP monoclonal antibody (M01A), clone 3D12
  • MRAP monoclonal antibody (M01A), clone 3D12

MRAP monoclonal antibody (M01A), clone 3D12

Ref: AB-H00056246-M01A
MRAP monoclonal antibody (M01A), clone 3D12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MRAP.
Información adicional
Size 200 uL
Gene Name MRAP
Gene Alias B27|C21orf61|FALP|FGD2|GCCD2
Gene Description melanocortin 2 receptor accessory protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RNSPKHHQTCPWSHGLNLHLCIQKCLPCHREPLATSQAQASSVEPGSRTGPDQPLRQESSSTLPLGGFQTHPTLLWELTLNGGPLVRSKPSEPPPGDRTSQLQS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MRAP (NP_848932.1, 69 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 56246
Clone Number 3D12
Iso type IgM Kappa

Enviar un mensaje


MRAP monoclonal antibody (M01A), clone 3D12

MRAP monoclonal antibody (M01A), clone 3D12