ZNF253 purified MaxPab rabbit polyclonal antibody (D01P)
  • ZNF253 purified MaxPab rabbit polyclonal antibody (D01P)

ZNF253 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00056242-D01P
ZNF253 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ZNF253 protein.
Información adicional
Size 100 ug
Gene Name ZNF253
Gene Alias BMZF-1|BMZF1|FLJ90391|ZNF411
Gene Description zinc finger protein 253
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce
Immunogen Prot. Seq MGPLQFRDVAIEFSLEEWHCLDTAQRNLYRDVMLENYRNLVFLGIVVSKPDLVTCLEQGKKPLTMERHEMIAKPPVMSSHFAQDLWPENIQNSFQIGMLRRYEECRHDNLQLKKGCKSVGEHKVHKGGYNGLNQCLTTTQKEIFQCDKYGKVFHKFSNSNTYKTRHTGINLFKCIICGKAFKRSSTLTTHKKIHTGEKPYRCEECGKAFNQSANLTTHKRIHTGEKPYRCEECGKAFKQSSNLTTHKKIHTGEKP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF253 (NP_066385.2, 1 a.a. ~ 499 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56242

Enviar un mensaje


ZNF253 purified MaxPab rabbit polyclonal antibody (D01P)

ZNF253 purified MaxPab rabbit polyclonal antibody (D01P)