PCDHA1 monoclonal antibody (M03), clone 3A3
  • PCDHA1 monoclonal antibody (M03), clone 3A3

PCDHA1 monoclonal antibody (M03), clone 3A3

Ref: AB-H00056147-M03
PCDHA1 monoclonal antibody (M03), clone 3A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDHA1.
Información adicional
Size 100 ug
Gene Name PCDHA1
Gene Alias PCDH-ALPHA1
Gene Description protocadherin alpha 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DQAVYRVHLLETTANGTLVTTLNASDADEGVNGEVVFSFDSGISRDIQEKFKVDSSSGEIRLIDKLDYEETKSYEIQVKAVDKGSPPMSN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHA1 (NP_061723, 243 a.a. ~ 332 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56147
Clone Number 3A3
Iso type IgG2b Kappa

Enviar un mensaje


PCDHA1 monoclonal antibody (M03), clone 3A3

PCDHA1 monoclonal antibody (M03), clone 3A3