PCDHA3 polyclonal antibody (A01)
  • PCDHA3 polyclonal antibody (A01)

PCDHA3 polyclonal antibody (A01)

Ref: AB-H00056145-A01
PCDHA3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PCDHA3.
Información adicional
Size 50 uL
Gene Name PCDHA3
Gene Alias MGC141669|PCDH-ALPHA3
Gene Description protocadherin alpha 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LDVKRNDEEIKSLGLVLKKNLNREDTPKHYLLITAIDGGKPELTGTTQLKITVLDVNDNAPAFERTIYKVRLLENAPNGTLVVTVNATDLDEGVNKDIAYSFNTDMSA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHA3 (NP_061729, 180 a.a. ~ 287 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56145

Enviar un mensaje


PCDHA3 polyclonal antibody (A01)

PCDHA3 polyclonal antibody (A01)