PCDHAC2 polyclonal antibody (A01)
  • PCDHAC2 polyclonal antibody (A01)

PCDHAC2 polyclonal antibody (A01)

Ref: AB-H00056134-A01
PCDHAC2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PCDHAC2.
Información adicional
Size 50 uL
Gene Name PCDHAC2
Gene Alias MGC71598|PCDH-ALPHA-C2
Gene Description protocadherin alpha subfamily C, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HLGAPSPRYLELDLTSGALFVNERIDREALCEQRPRCLLSLEVLAHNPVAVSAVEVEILDINDNSPRFPRPNYQLQVSESVAPGARFHIESAQDPDVGANSVQTYELSPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHAC2 (NP_061722, 81 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56134

Enviar un mensaje


PCDHAC2 polyclonal antibody (A01)

PCDHAC2 polyclonal antibody (A01)