PCDHB2 purified MaxPab mouse polyclonal antibody (B01P)
  • PCDHB2 purified MaxPab mouse polyclonal antibody (B01P)

PCDHB2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00056133-B01P
PCDHB2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PCDHB2 protein.
Información adicional
Size 50 ug
Gene Name PCDHB2
Gene Alias MGC111392|PCDH-BETA2
Gene Description protocadherin beta 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEAGEGKERVPKQRQVLIFFVLLGIAQASCQPRHYSVAEETESGSFVANLLKDLGLEIGELAVRGARVVSKGKKMHLQFDRQTGDLLLNEKLDREELCGPTEPCVLPFQVLLENPLQFFQAELRIRDVNDHSPVFLDKEILLKIPESITPGTTFLIERAQDLDVGTNSLQNYTISPNFHFHLNLQDSLDGIILPQLVLNRALDREEQPEIRLTLTALDGGSPPRSGTALVRIEVVDINDNVPEFAKLLYEVQIPE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PCDHB2 (AAH98575.1, 1 a.a. ~ 798 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56133

Enviar un mensaje


PCDHB2 purified MaxPab mouse polyclonal antibody (B01P)

PCDHB2 purified MaxPab mouse polyclonal antibody (B01P)