PCDHB3 monoclonal antibody (M01), clone 4F6
  • PCDHB3 monoclonal antibody (M01), clone 4F6

PCDHB3 monoclonal antibody (M01), clone 4F6

Ref: AB-H00056132-M01
PCDHB3 monoclonal antibody (M01), clone 4F6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDHB3.
Información adicional
Size 100 ug
Gene Name PCDHB3
Gene Alias PCDH-BETA3
Gene Description protocadherin beta 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ASEEIRKTFQLNPITGDMQLVKYLNFEAINSYEVDIEAKDGGGLSGKSTVIVQVVDVNDNPPELTLSSVNSPIPENSGETVLAVFSVSDLDSGDNGRV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHB3 (NP_061760, 284 a.a. ~ 381 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56132
Clone Number 4F6
Iso type IgG2a Kappa

Enviar un mensaje


PCDHB3 monoclonal antibody (M01), clone 4F6

PCDHB3 monoclonal antibody (M01), clone 4F6