PCDHB6 monoclonal antibody (M01), clone 2G11
  • PCDHB6 monoclonal antibody (M01), clone 2G11

PCDHB6 monoclonal antibody (M01), clone 2G11

Ref: AB-H00056130-M01
PCDHB6 monoclonal antibody (M01), clone 2G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDHB6.
Información adicional
Size 100 ug
Gene Name PCDHB6
Gene Alias PCDH-BETA6
Gene Description protocadherin beta 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq ASLRVRDINDHAPEFPAREMLLKISEITMPGKIFPLKMAHDLDTGSNGLQRYTISSNPHFHVLTRNRSEGRKFPELVLDKPLDREEQPQLRLTLIALDGG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHB6 (NP_061762, 118 a.a. ~ 217 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56130
Clone Number 2G11
Iso type IgG2a Kappa

Enviar un mensaje


PCDHB6 monoclonal antibody (M01), clone 2G11

PCDHB6 monoclonal antibody (M01), clone 2G11