PCDHB10 monoclonal antibody (M07), clone 4C4
  • PCDHB10 monoclonal antibody (M07), clone 4C4

PCDHB10 monoclonal antibody (M07), clone 4C4

Ref: AB-H00056126-M07
PCDHB10 monoclonal antibody (M07), clone 4C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDHB10.
Información adicional
Size 100 ug
Gene Name PCDHB10
Gene Alias PCDH-BETA10|PCHB10
Gene Description protocadherin beta 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA,IF
Immunogen Prot. Seq GSGFGRYSVTEETEKGSFVVNLAKDLGLAEGELAARGTRVVSDDNKQYLLLDSHTGNLLTNEKLDREKLCGPKEPCMLYFQILMDDPFQIYRAELRVRD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHB10 (NP_061753, 27 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56126
Clone Number 4C4
Iso type IgG2a Kappa

Enviar un mensaje


PCDHB10 monoclonal antibody (M07), clone 4C4

PCDHB10 monoclonal antibody (M07), clone 4C4