PCDHB10 polyclonal antibody (A01)
  • PCDHB10 polyclonal antibody (A01)

PCDHB10 polyclonal antibody (A01)

Ref: AB-H00056126-A01
PCDHB10 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PCDHB10.
Información adicional
Size 50 uL
Gene Name PCDHB10
Gene Alias PCDH-BETA10|PCHB10
Gene Description protocadherin beta 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GSGFGRYSVTEETEKGSFVVNLAKDLGLAEGELAARGTRVVSDDNKQYLLLDSHTGNLLTNEKLDREKLCGPKEPCMLYFQILMDDPFQIYRAELRVRD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHB10 (NP_061753, 27 a.a. ~ 125 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56126

Enviar un mensaje


PCDHB10 polyclonal antibody (A01)

PCDHB10 polyclonal antibody (A01)