PCDHB11 monoclonal antibody (M03), clone 4F11
  • PCDHB11 monoclonal antibody (M03), clone 4F11

PCDHB11 monoclonal antibody (M03), clone 4F11

Ref: AB-H00056125-M03
PCDHB11 monoclonal antibody (M03), clone 4F11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDHB11.
Información adicional
Size 100 ug
Gene Name PCDHB11
Gene Alias ME2|MGC138337|MGC142171|PCDH-BETA11
Gene Description protocadherin beta 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq GSETWSFSVAEEMQSGSFVGNLAKDLGLKVRELSSRGARVVSNDKKQRLQLDINTGDLLLSETLDREELCGSIEPCVLHLQVLMQNPTQFLQIELQVRDI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHB11 (NP_061754, 27 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56125
Clone Number 4F11
Iso type IgG2b Kappa

Enviar un mensaje


PCDHB11 monoclonal antibody (M03), clone 4F11

PCDHB11 monoclonal antibody (M03), clone 4F11