PCDHB12 monoclonal antibody (M05), clone 1D11
  • PCDHB12 monoclonal antibody (M05), clone 1D11

PCDHB12 monoclonal antibody (M05), clone 1D11

Ref: AB-H00056124-M05
PCDHB12 monoclonal antibody (M05), clone 1D11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDHB12.
Información adicional
Size 100 ug
Gene Name PCDHB12
Gene Alias PCDH-BETA12
Gene Description protocadherin beta 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ITLTAPLDFEAIESYSIIIQATDGGGLFGKSTVRIQVMDVNDNAPEITVSSITSPIPENTPETVVMVFRIRDRDSGDNGKMVCSIPEDIPFVLKSSVNNY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHB12 (NP_061755, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56124
Clone Number 1D11
Iso type IgG2a Kappa

Enviar un mensaje


PCDHB12 monoclonal antibody (M05), clone 1D11

PCDHB12 monoclonal antibody (M05), clone 1D11