PCDHB15 monoclonal antibody (M02), clone 2E10
  • PCDHB15 monoclonal antibody (M02), clone 2E10

PCDHB15 monoclonal antibody (M02), clone 2E10

Ref: AB-H00056121-M02
PCDHB15 monoclonal antibody (M02), clone 2E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDHB15.
Información adicional
Size 100 ug
Gene Name PCDHB15
Gene Alias PCDH-BETA15
Gene Description protocadherin beta 15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ELRLTLTAVDGGSPPRSGTVQILILVLDANDNAPEFVQALYEVQVPENSPVGSLVVKVSARDLDTGTNGEISYSLYYSSQEIDKPFELSSLSGEIRLIKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHB15 (NP_061758, 207 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56121
Clone Number 2E10
Iso type IgG2a Kappa

Enviar un mensaje


PCDHB15 monoclonal antibody (M02), clone 2E10

PCDHB15 monoclonal antibody (M02), clone 2E10