PCDHGA2 monoclonal antibody (M01), clone 2A7
  • PCDHGA2 monoclonal antibody (M01), clone 2A7

PCDHGA2 monoclonal antibody (M01), clone 2A7

Ref: AB-H00056113-M01
PCDHGA2 monoclonal antibody (M01), clone 2A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDHGA2.
Información adicional
Size 100 ug
Gene Name PCDHGA2
Gene Alias PCDH-GAMMA-A2
Gene Description protocadherin gamma subfamily A, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq SGTSRICVKVLDANDNAPVFTQPEYRISIPENTLVGTRILTVTATDADEGYYAQVVYFLEKSPGETSEVFELKSTSGELTIIKDLDYEDATFHEIDIEAQDGPGLLTRA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHGA2 (NP_061738, 223 a.a. ~ 331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56113
Clone Number 2A7
Iso type IgG2a Kappa

Enviar un mensaje


PCDHGA2 monoclonal antibody (M01), clone 2A7

PCDHGA2 monoclonal antibody (M01), clone 2A7