PCDHGA6 polyclonal antibody (A01)
  • PCDHGA6 polyclonal antibody (A01)

PCDHGA6 polyclonal antibody (A01)

Ref: AB-H00056109-A01
PCDHGA6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PCDHGA6.
Información adicional
Size 50 uL
Gene Name PCDHGA6
Gene Alias PCDH-GAMMA-A6
Gene Description protocadherin gamma subfamily A, 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KITEKISQIFCLNVLTGEISTSANLDYEDSSFYELGVEARDGPGLRDRAKVLITILDVNDNVPEVVVTSGSRTIAESAPPGTVIALFQVFDRDSGLNGLVTCSIPRSLP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHGA6 (NP_061742, 283 a.a. ~ 391 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56109

Enviar un mensaje


PCDHGA6 polyclonal antibody (A01)

PCDHGA6 polyclonal antibody (A01)