PCDHGA7 polyclonal antibody (A01)
  • PCDHGA7 polyclonal antibody (A01)

PCDHGA7 polyclonal antibody (A01)

Ref: AB-H00056108-A01
PCDHGA7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PCDHGA7.
Información adicional
Size 50 uL
Gene Name PCDHGA7
Gene Alias PCDH-GAMMA-A7
Gene Description protocadherin gamma subfamily A, 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq VTMTSLSSSIPEDTPLGTVIALFYLQDRDSGKNGEVTCTIPENLPFKLEKSIDNYYRLVTTKNLDRETLSLYNITLKATDGGTPPLSRETHIFMQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHGA7 (NP_061743, 347 a.a. ~ 441 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56108

Enviar un mensaje


PCDHGA7 polyclonal antibody (A01)

PCDHGA7 polyclonal antibody (A01)