PCDHGB1 polyclonal antibody (A01)
  • PCDHGB1 polyclonal antibody (A01)

PCDHGB1 polyclonal antibody (A01)

Ref: AB-H00056104-A01
PCDHGB1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PCDHGB1.
Información adicional
Size 50 uL
Gene Name PCDHGB1
Gene Alias MGC119466|MGC119467|MGC119469|PCDH-GAMMA-B1
Gene Description protocadherin gamma subfamily B, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,ELISA
Immunogen Prot. Seq FNLNPNTGDITTNGTLDFEETSRYVLSVEAKDGGVHTAHCNVQIEIVDENDNAPEVTFMSFSNQIPEDSDLGTVIALIKVRDKDSGQNGMVTCYTQEEVP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHGB1 (NP_061745, 288 a.a. ~ 387 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56104

Enviar un mensaje


PCDHGB1 polyclonal antibody (A01)

PCDHGB1 polyclonal antibody (A01)