PCDHGB2 monoclonal antibody (M02), clone 6E9
  • PCDHGB2 monoclonal antibody (M02), clone 6E9

PCDHGB2 monoclonal antibody (M02), clone 6E9

Ref: AB-H00056103-M02
PCDHGB2 monoclonal antibody (M02), clone 6E9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDHGB2.
Información adicional
Size 100 ug
Gene Name PCDHGB2
Gene Alias MGC126854|PCDH-GAMMA-B2
Gene Description protocadherin gamma subfamily B, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QICGKQPLCVLDFDTVAENPLNIFYIAVIVQDINDNTPLFKQTKINLKIGESTKPGTTFPLDPALDSDVGPNSLQRYHLNDNEYFDLAEKQTPDGRKYPELILKHS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHGB2 (NP_061746, 94 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56103
Clone Number 6E9
Iso type IgG2a Kappa

Enviar un mensaje


PCDHGB2 monoclonal antibody (M02), clone 6E9

PCDHGB2 monoclonal antibody (M02), clone 6E9