PCDHGB2 polyclonal antibody (A01)
  • PCDHGB2 polyclonal antibody (A01)

PCDHGB2 polyclonal antibody (A01)

Ref: AB-H00056103-A01
PCDHGB2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PCDHGB2.
Información adicional
Size 50 uL
Gene Name PCDHGB2
Gene Alias MGC126854|PCDH-GAMMA-B2
Gene Description protocadherin gamma subfamily B, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QICGKQPLCVLDFDTVAENPLNIFYIAVIVQDINDNTPLFKQTKINLKIGESTKPGTTFPLDPALDSDVGPNSLQRYHLNDNEYFDLAEKQTPDGRKYPELILKHS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHGB2 (NP_061746, 94 a.a. ~ 199 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56103

Enviar un mensaje


PCDHGB2 polyclonal antibody (A01)

PCDHGB2 polyclonal antibody (A01)