PCDHGB5 polyclonal antibody (A01)
  • PCDHGB5 polyclonal antibody (A01)

PCDHGB5 polyclonal antibody (A01)

Ref: AB-H00056101-A01
PCDHGB5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PCDHGB5.
Información adicional
Size 50 uL
Gene Name PCDHGB5
Gene Alias PCDH-GAMMA-B5
Gene Description protocadherin gamma subfamily B, 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RTGQIFSLNSKSGEITTQKKLDFEETKEYSMVVEGRDGGGLVAQCTVEINIQDENDNSPEVTFHSLLEMILENAVPGTLIALIKIHDQDSG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHGB5 (NP_061748, 283 a.a. ~ 373 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56101

Enviar un mensaje


PCDHGB5 polyclonal antibody (A01)

PCDHGB5 polyclonal antibody (A01)