PCDHGB7 polyclonal antibody (A01)
  • PCDHGB7 polyclonal antibody (A01)

PCDHGB7 polyclonal antibody (A01)

Ref: AB-H00056099-A01
PCDHGB7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PCDHGB7.
Información adicional
Size 50 uL
Gene Name PCDHGB7
Gene Alias ME6|PCDH-GAMMA-B7
Gene Description protocadherin gamma subfamily B, 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq TLDRETQSAHHLVLTALDGGDPPRSGTAQIRILVIDANDNPPVFSQDVYRVSLREDVPPGTSILRVKATDQDEGINSEITYSFFGVADKAQHV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHGB7 (NP_061750, 199 a.a. ~ 291 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56099

Enviar un mensaje


PCDHGB7 polyclonal antibody (A01)

PCDHGB7 polyclonal antibody (A01)