PCDHGC5 monoclonal antibody (M08), clone 3A6
  • PCDHGC5 monoclonal antibody (M08), clone 3A6

PCDHGC5 monoclonal antibody (M08), clone 3A6

Ref: AB-H00056097-M08
PCDHGC5 monoclonal antibody (M08), clone 3A6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDHGC5.
Información adicional
Size 100 ug
Gene Name PCDHGC5
Gene Alias MGC138286|MGC138288|PCDH-GAMMA-C5
Gene Description protocadherin gamma subfamily C, 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RPPGSLLCTVAASDPDTGDNARLTYSIVGNQVQGAPASSFVYVNPEDGRIFAQRTFDYELLQMLQIVVGVRDSGSPPLHANTSLHVFVLDENDNAPAVLHPRPDWEHSA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHGC5 (NP_061752, 467 a.a. ~ 575 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56097
Clone Number 3A6
Iso type IgG2a Kappa

Enviar un mensaje


PCDHGC5 monoclonal antibody (M08), clone 3A6

PCDHGC5 monoclonal antibody (M08), clone 3A6