ALG1 purified MaxPab rabbit polyclonal antibody (D01P)
  • ALG1 purified MaxPab rabbit polyclonal antibody (D01P)

ALG1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00056052-D01P
ALG1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ALG1 protein.
Información adicional
Size 100 ug
Gene Name ALG1
Gene Alias HMAT1|HMT-1|HMT1
Gene Description asparagine-linked glycosylation 1, beta-1,4-mannosyltransferase homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MAASCLVLLALCLLLPLLLLGGWKRWRRGRAARHVVAVVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVGLTELQSLAVGPRVFQYGVKVVLQAMYLLWKLMWREPGAYIFLQNPPGLPSIAVCWFVGCLCGSKLVIDWHNYGYSIMGLVHGPNHPLVLLAKWYEKFFGRLSHLNLCVTNAMREDLADNWHIRAVTVYDKPASFFKETPLDLQHRLFMKLGSMHSPFRARSEPEDPVT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ALG1 (NP_061982.3, 1 a.a. ~ 464 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56052

Enviar un mensaje


ALG1 purified MaxPab rabbit polyclonal antibody (D01P)

ALG1 purified MaxPab rabbit polyclonal antibody (D01P)