BARX1 MaxPab mouse polyclonal antibody (B01P)
  • BARX1 MaxPab mouse polyclonal antibody (B01P)

BARX1 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00056033-B01P
BARX1 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BARX1 protein.
Información adicional
Size 50 ug
Gene Name BARX1
Gene Alias -
Gene Description BARX homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPTSEQLTEQERAKDAEKPAEVPGEPSDRSRED
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BARX1 (AAH09458.1, 1 a.a. ~ 100 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56033

Enviar un mensaje


BARX1 MaxPab mouse polyclonal antibody (B01P)

BARX1 MaxPab mouse polyclonal antibody (B01P)