BCAP29 monoclonal antibody (M07), clone 4B10
  • BCAP29 monoclonal antibody (M07), clone 4B10

BCAP29 monoclonal antibody (M07), clone 4B10

Ref: AB-H00055973-M07
BCAP29 monoclonal antibody (M07), clone 4B10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant BCAP29.
Información adicional
Size 100 ug
Gene Name BCAP29
Gene Alias BAP29|DKFZp686M2086
Gene Description B-cell receptor-associated protein 29
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq TQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKRL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BCAP29 (AAH08478, 125 a.a. ~ 241 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55973
Clone Number 4B10
Iso type IgG2a Kappa

Enviar un mensaje


BCAP29 monoclonal antibody (M07), clone 4B10

BCAP29 monoclonal antibody (M07), clone 4B10