BCAP29 purified MaxPab rabbit polyclonal antibody (D01P)
  • BCAP29 purified MaxPab rabbit polyclonal antibody (D01P)

BCAP29 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055973-D01P
BCAP29 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human BCAP29 protein.
Información adicional
Size 100 ug
Gene Name BCAP29
Gene Alias BAP29|DKFZp686M2086
Gene Description B-cell receptor-associated protein 29
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLIVLFLDAVREVRKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKRL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BCAP29 (NP_061332.2, 1 a.a. ~ 241 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55973

Enviar un mensaje


BCAP29 purified MaxPab rabbit polyclonal antibody (D01P)

BCAP29 purified MaxPab rabbit polyclonal antibody (D01P)