APOM monoclonal antibody (M06), clone 6H3
  • APOM monoclonal antibody (M06), clone 6H3

APOM monoclonal antibody (M06), clone 6H3

Ref: AB-H00055937-M06
APOM monoclonal antibody (M06), clone 6H3

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant APOM.
Información adicional
Size 100 ug
Gene Name APOM
Gene Alias G3a|HSPC336|MGC22400|NG20
Gene Description apolipoprotein M
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen APOM (AAH20683, 23 a.a. ~ 188 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55937
Clone Number 6H3
Iso type IgG2b Kappa

Enviar un mensaje


APOM monoclonal antibody (M06), clone 6H3

APOM monoclonal antibody (M06), clone 6H3