NKRF purified MaxPab mouse polyclonal antibody (B01P)
  • NKRF purified MaxPab mouse polyclonal antibody (B01P)

NKRF purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055922-B01P
NKRF purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NKRF protein.
Información adicional
Size 50 ug
Gene Name NKRF
Gene Alias ITBA4|NRF
Gene Description NFKB repressing factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEKILQMAEGIDIGEMPSYDLVLSKPSKGQKRHLSTCDGQNPPKKQAGSKFHARPRFEPVHFVASSSKDERQEDPYGPQTKEVNEQTHFASMPRDIYQDYTQDSFSIQDGNSQYCDSSGFILTKDQPVTANMYFDSGNPAPSTTSQQANSQSTPEPSPSQTFPESVVAEKQYFIEKLTATIWKNLSNPEMTSGSDKINYTYMLTRCIQACKTNPEYIYAPLKEIPPADIPKNKKLLTDGYACEVRCQNIYLTTGY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NKRF (AAH68514.1, 1 a.a. ~ 690 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55922

Enviar un mensaje


NKRF purified MaxPab mouse polyclonal antibody (B01P)

NKRF purified MaxPab mouse polyclonal antibody (B01P)