ERBB2IP polyclonal antibody (A01)
  • ERBB2IP polyclonal antibody (A01)

ERBB2IP polyclonal antibody (A01)

Ref: AB-H00055914-A01
ERBB2IP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ERBB2IP.
Información adicional
Size 50 uL
Gene Name ERBB2IP
Gene Alias ERBIN|LAP2
Gene Description erbb2 interacting protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq QGHELAKQEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ERBB2IP (NP_061165, 1272 a.a. ~ 1371 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55914

Enviar un mensaje


ERBB2IP polyclonal antibody (A01)

ERBB2IP polyclonal antibody (A01)