C19orf80 purified MaxPab mouse polyclonal antibody (B01P)
  • C19orf80 purified MaxPab mouse polyclonal antibody (B01P)

C19orf80 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055908-B01P
C19orf80 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C19orf80 protein.
Información adicional
Size 50 ug
Gene Name C19orf80
Gene Alias RIFL|TD26|PRO1185|PVPA599
Gene Description chromosome 19 open reading frame 80
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGDALPPFPGAQPLTGRAWLGSSPVMYCTRTARLRTEPWRLLKLRLLYLRPSVMPVPALCLLWALAMVTRPASAAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C19orf80 (AAI46553.1, 1 a.a. ~ 251 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55908

Enviar un mensaje


C19orf80 purified MaxPab mouse polyclonal antibody (B01P)

C19orf80 purified MaxPab mouse polyclonal antibody (B01P)