ACSS2 monoclonal antibody (M09), clone 2A10
  • ACSS2 monoclonal antibody (M09), clone 2A10

ACSS2 monoclonal antibody (M09), clone 2A10

Ref: AB-H00055902-M09
ACSS2 monoclonal antibody (M09), clone 2A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ACSS2.
Información adicional
Size 100 ug
Gene Name ACSS2
Gene Alias ACAS2|ACS|ACSA|AceCS|DKFZp762G026|dJ1161H23.1
Gene Description acyl-CoA synthetase short-chain family member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq PPEVSRSAHVPSLQRYRELHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACSS2 (NP_061147.1, 32 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55902
Clone Number 2A10
Iso type IgG2a Kappa

Enviar un mensaje


ACSS2 monoclonal antibody (M09), clone 2A10

ACSS2 monoclonal antibody (M09), clone 2A10